DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and Lrrk

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_001262772.1 Gene:Lrrk / 42447 FlyBaseID:FBgn0038816 Length:2513 Species:Drosophila melanogaster


Alignment Length:818 Identity:168/818 - (20%)
Similarity:260/818 - (31%) Gaps:339/818 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PMHSIRLVEIP---KDATPGLRVDGVAL---DDGCPTVRITDLFCNFFLWLTSMAEQCCGAPYRI 226
            |:...::.|:|   .:.|...|.||...   .||              :|              .
  Fly  1512 PILIFKIWEVPFQKTERTQPFRTDGNRFKLKQDG--------------IW--------------S 1548

  Fly   227 DVNLTN---LHIGDRILEVNGTPVSDSSVEQIDKLIRSN----EKMLQLTVEH------------ 272
            ||||::   |.:...:.|||.:...|.:..|:...||.:    .|:|.|||:|            
  Fly  1549 DVNLSSSSILEVYFPLYEVNISQEVDDNERQLLAEIRPHMSQVAKLLALTVDHIDLLLEDWYPSL 1613

  Fly   273 --------------DPVQVCRSCS-QADIQRAMSASTLILPLSTSASSVEVGRERLYKT------ 316
                          ..:.:|..|. :..:|:....|...:|        .||..|..::      
  Fly  1614 GTRFVHTSEGRFLITRLVLCPRCLWKLQLQQNNEPSDREVP--------PVGCNRPSRSSRRGAG 1670

  Fly   317 ---------PGEQG----------TKARKLRQATNA--------STTIPPAAGATAMTQLKEKER 354
                     |||.|          ..||:.|::.::        |...|.:||::..|.:     
  Fly  1671 AYFLHGVGDPGEDGALNVFSAYLNATARRERRSEDSLGAGSDADSGVGPDSAGSSRNTSV----- 1730

  Fly   355 CSSLSKLLDEQHQAQQHSAHP---------------------QLYDLSRTQSCRVVQKPQRIFRA 398
                             ..||                     .:|:.|:. ||.|..:......|
  Fly  1731 -----------------DGHPGYHLPDNSNVCYAWMIEECILSVYNQSKI-SCPVHLEQSMAQLA 1777

  Fly   399 TDLVI----------------GEKLGEGFFGKVF----KVTHRQSGEVMVLKELH------RADE 437
            .|::.                |..||.|.||.||    ||...:|.:.:.:|.|.      ||.|
  Fly  1778 PDVIFADIPDKHTIPSECIIKGSLLGRGAFGFVFKANCKVRGARSFKPVAMKMLQPVPPGARAKE 1842

  Fly   438 EAQRNF----------------------IKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAG 480
            .|...|                      .:|:|||..|.|.:::..:|:..  |.|.:|.|....
  Fly  1843 SALMAFKVAVGKWDRDPLQHSCKAYCTARQELAVLLTLKHPNIVPLVGICI--KPLALVLELAPL 1905

  Fly   481 GCLKELI----HDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNCLVRE--------- 532
            |.|..|:    ...|.:.|...:. |....|..:.|||...||:|||.|.|.||.|         
  Fly  1906 GGLDALLRHYRRSGAHMGPHTFQT-LVLQAARAIEYLHRRRIIYRDLKSENVLVWELPQPHTEDS 1969

  Fly   533 DRSVI---VADFGLARSVDAPRLPSGNMTPGGYGSGANSDAPMSPSGTLRRSKSRQRRQRYTVVG 594
            .|:::   :||:|::|..    .|||   ..|:|                              |
  Fly  1970 PRNLVHIKIADYGISRQT----APSG---AKGFG------------------------------G 1997

  Fly   595 NPYWMAPEMMK---GLKYDEKVDVFSFGIMLCEII-------GRVEADPDFMPRNSDFSLNQQEF 649
            ...:||||:::   ..:|.||||.||||:.:.|.|       |. |:..:.:...|..:|.|:| 
  Fly  1998 TEGFMAPEIIRYNGEEEYTEKVDCFSFGMFIYENISLRQPFEGH-ESIKECILEGSRPALTQRE- 2060

  Fly   650 REKFCAQCPEPFVKVAFVCCDLNPDMRP-------------CFETLHV---------------WL 686
                 .|.|...:.:..:|....|..||             |...|.|               .|
  Fly  2061 -----TQFPTCCLDLMVLCWHEQPRRRPTASQIVSILSAPECIHLLDVVAMPHSEKIVCGVFQSL 2120

  Fly   687 QRLADDLAADRVPPERLLHEIETFQEWYASSEDALSPTSQRSLNNLDELVKSAVDSEISPVEKEK 751
            ..:.||        ||.  .:|.:...:.|..|.|..:...||...:. :..:...:::|     
  Fly  2121 VGMGDD--------ERC--GLELWLPSFGSRIDILDCSPSGSLLQCNS-ISCSPQPQVAP----- 2169

  Fly   752 ENMVIKPQDIPKSPHLGKDFSPSGERLRDSMRARRRQR 789
                      ||:|..|.           :.|||..||
  Fly  2170 ----------PKTPENGA-----------NSRARSAQR 2186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492 25/111 (23%)
STKc_LIMK 407..693 CDD:271056 91/371 (25%)
LrrkNP_001262772.1 Ank_2 111..200 CDD:289560
ANK 146..286 CDD:238125
ANK repeat 146..177 CDD:293786
Ank_4 179..232 CDD:290365
ANK repeat 179..209 CDD:293786
Ank_2 216..389 CDD:289560
ANK 361..477 CDD:238125
ANK repeat 361..390 CDD:293786
Ank_2 364..464 CDD:289560
ANK repeat 406..435 CDD:293786
ANK repeat 437..464 CDD:293786
LRR_8 <544..580 CDD:290566
leucine-rich repeat 547..569 CDD:275380
LRR_8 569..629 CDD:290566
leucine-rich repeat 570..595 CDD:275380
leucine-rich repeat 596..618 CDD:275380
leucine-rich repeat 619..641 CDD:275380
leucine-rich repeat 642..676 CDD:275380
leucine-rich repeat 677..730 CDD:275380
LRR_8 729..788 CDD:290566
leucine-rich repeat 731..754 CDD:275380
LRR_8 855..933 CDD:290566
leucine-rich repeat 855..901 CDD:275380
leucine-rich repeat 902..924 CDD:275380
leucine-rich repeat 925..949 CDD:275380
P-loop_NTPase 993..1211 CDD:304359
COR 1230..1471 CDD:292713
STYKc 1796..2092 CDD:214568 87/342 (25%)
STKc_LRRK 1801..2095 CDD:270902 86/340 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.