DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and Mos

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:96/247 - (38%) Gaps:74/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 LGEGFFGKVFKVTHR-QSGEVMVLKELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDKK 470
            ||.|.:|.|||..:| :|..|.:::      .:|......|..:|. |:||::::.:       |
  Fly    28 LGRGAYGTVFKAIYRDRSVAVKIIR------AQAASTLHNESHLLN-LEHRNIVRLL-------K 78

  Fly   471 LH-------MVTEYVAGGCLKELIHDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNC 528
            |.       ::.|...|..|:.::...|  ||...||.:..|:...:.|.||.|::|.|:...|.
  Fly    79 LESAADFGLVIMECPRGQSLQRIVDTLA--LPLMHRVLITLDVVAALRYCHSQNVLHLDVKPTNI 141

  Fly   529 LV---------------REDRSVI--VADFGLARSVDAPRLPSGNMTPGGYGSGANSDAPMSPSG 576
            ||               :..||.|  :.|||  .|::             .|.......|....|
  Fly   142 LVALGTKSSITCNSSKIKVKRSYICKLCDFG--SSIE-------------MGEFCAWQEPSVAKG 191

  Fly   577 TLRRSKSRQRRQRYTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEIIGR 628
            |||                  :|:||.::.....|..|::|.||.:.::..|
  Fly   192 TLR------------------YMSPEALRSDTLTEASDIYSLGITMWQLQAR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492
STKc_LIMK 407..693 CDD:271056 58/247 (23%)
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 58/247 (23%)
S_TKc 26..257 CDD:214567 58/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.