DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIMK1 and Araf

DIOPT Version :9

Sequence 1:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:XP_011245731.2 Gene:Araf / 11836 MGIID:88065 Length:674 Species:Mus musculus


Alignment Length:589 Identity:136/589 - (23%)
Similarity:217/589 - (36%) Gaps:165/589 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 FCNFFLWLTSMAEQC--CGAPYR-----------IDVNLTNLHIGDRILEVNGTPVSDSSVEQID 256
            ||:|.|.......:|  ||..:.           :|::.........|.:::|    .|..::..
Mouse   181 FCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSG----GSRQQEAP 241

  Fly   257 KLIRSNEKML---------QLTVEH--------DPVQVCRSCSQADIQRAMSA----STLILPLS 300
            ..:..||.:.         |...||        .|:|..||.|..::....:.    |:|:...:
Mouse   242 SNLSVNELLTPQGPSPFTQQRDQEHFSFPAPANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTA 306

  Fly   301 TSASSVEVGRERLYKTPGEQGTKARKLRQATNASTTIPPAAGATAMTQLKEKERCSSLSKLLDEQ 365
            .|.|:...||       |..|        |...|.:  ||:.::.        |.|..|||..||
Mouse   307 QSFSTDAAGR-------GGDG--------APRGSPS--PASVSSG--------RKSPHSKLPSEQ 346

  Fly   366 HQAQQ-HSAHPQLYDLSRTQSCRVVQKPQRIFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVL 429
            .:.:. .....::.:|....|....:.|     .:::.:.:::|.|.||.||:........|.||
Mouse   347 RERKSLADEKKKVKNLGYRDSGYYWEVP-----PSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVL 406

  Fly   430 KELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVL 494
            |......|:||. |..|:.|||...|.::|.|:|.:.: ....::|::..|..|...:|......
Mouse   407 KVAQPTAEQAQA-FKNEMQVLRKTRHVNILLFMGFMTR-PGFAIITQWCEGSSLYHHLHVADTRF 469

  Fly   495 PWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNCLVREDRSVIVADFGLARSVDAPRLPSGNMTP 559
            ...|.:.:||..|.||.|||:.|||||||.|.|..:.|..:|.:.|||||             |.
Mouse   470 DMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLA-------------TV 521

  Fly   560 GGYGSGANSDAPM-SPSGTLRRSKSRQRRQRYTVVGNPYWMAPE---MMKGLKYDEKVDVFSFGI 620
            ....|||.   |: .|||::                  .|||.|   |.....|..:.||:::|:
Mouse   522 KTRWSGAQ---PLEQPSGSV------------------LWMAAEVIRMQDPNPYSFQSDVYAYGV 565

  Fly   621 MLCEI-------------------IGRVEADPDFMPRNSDFSLNQQEFREKFCAQCPEPFVKVAF 666
            :|.|:                   :||....||.               .|..:.||:...::..
Mouse   566 VLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDL---------------SKIFSNCPKAMRRLLT 615

  Fly   667 VCCDLNPDMRPCFETLHVWLQRLADDLAADRVPPERLLHEIETFQEWYASSEDALSPTSQRSLNN 731
            .|.....:.||.|..:...::.|           :|.|.:||.     ::||.:|..|      .
Mouse   616 DCLKFQREERPLFPQILATIELL-----------QRSLPKIER-----SASEPSLHRT------Q 658

  Fly   732 LDEL 735
            .|||
Mouse   659 ADEL 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492 14/87 (16%)
STKc_LIMK 407..693 CDD:271056 82/308 (27%)
ArafXP_011245731.2 RBD_ARAF 89..161 CDD:340653
C1_1 169..214 CDD:365894 7/32 (22%)
PKc_like 377..641 CDD:389743 82/325 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.