DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pits and Myt1l

DIOPT Version :9

Sequence 1:NP_001138192.1 Gene:Pits / 32205 FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_038967595.1 Gene:Myt1l / 116668 RGDID:620550 Length:1189 Species:Rattus norvegicus


Alignment Length:375 Identity:78/375 - (20%)
Similarity:114/375 - (30%) Gaps:110/375 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 RQLSG----LRDKQQPVRAPSF--DAS-TFKAANPIPNP-----------IPHHLHIAEHMSPAS 348
            |||:|    .:.....|:.|.:  |.| |.|..:..|.|           .|||           
  Rat   472 RQLAGEDRKSKSSDSHVKKPYYGKDPSRTEKRESKCPTPGCDGTGHVTGLYPHH----------- 525

  Fly   349 RRNGSSPPSGPLPPR--SVH-------SPNSSGS---SSGRRSSGSRHVSSTTVTSSE--VGGSN 399
            |.....|....:||.  ::|       :|..:|.   :|.|.|  .|.:|...:.::|  .....
  Rat   526 RSLSGCPHKDRVPPEILAMHENVLKCPTPGCTGRGHVNSNRNS--HRSLSGCPIAAAEKLAKAQE 588

  Fly   400 PGQAVVAGGLGGGGGGGPGSNAASGQLGGPSGGSGQLSCTSGG---------PGGSASS------ 449
            ..|:....          .||.||.::..|.....||.....|         |..:.:.      
  Rat   589 KHQSCDVS----------KSNQASDRVLRPMCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYS 643

  Fly   450 ------GSGGNGAIGPASMAPNSVAGDGSPAG---------GNGPSGSNGSGGSVNPGPGSSGSQ 499
                  .|..|...|..::||.....|.||.|         ...||.|..|    :..|.||.: 
  Rat   644 KTSFEYNSYDNHTYGKRAIAPKVQTRDISPKGYDDAKRYCKNASPSSSTTS----SYAPSSSSN- 703

  Fly   500 GGGGGGTPLASGGGSAGSGGLGGAPGSSAASNSAAAAAAAAAQNATLKCTLCQERLEDTHFVQCP 564
                    |:.||||:.|.....:.........||..||.|..|.:.:|....:.|         
  Rat   704 --------LSCGGGSSASSTCSKSSFDYTHDMEAAHMAATAILNLSTRCREMPQNL--------- 751

  Fly   565 SVNHHKFCFPCSRESIKRQNG---LGNEVYCPSGDRCPLANSVIPWAFMQ 611
            |......|...:.:....:||   |......|....||:...:.|.:..|
  Rat   752 STKPQDLCTARNPDMEVDENGTLDLSMNKQRPRDSCCPVLTPLEPMSPQQ 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155
zf-C3HC4 548..593 CDD:278524 7/47 (15%)
Myt1lXP_038967595.1 zf-C2HC 30..58 CDD:396216
zf-C2HC 506..532 CDD:396216 6/36 (17%)
zf-C2HC 550..578 CDD:396216 7/29 (24%)
MYT1 622..873 CDD:400668 41/202 (20%)
zf-C2HC 905..933 CDD:396216
zf-C2HC 954..982 CDD:396216
zf-C2HC 1007..1035 CDD:396216
Smc <1034..1188 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.