powered by:
Protein Alignment Cpr11B and Cpr65Au
DIOPT Version :9
Sequence 1: | NP_572807.1 |
Gene: | Cpr11B / 32203 |
FlyBaseID: | FBgn0030398 |
Length: | 197 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286953.1 |
Gene: | Cpr65Au / 59158 |
FlyBaseID: | FBgn0042119 |
Length: | 106 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 29/65 - (44%) |
Similarity: | 43/65 - (66%) |
Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 NSDANGNYNFGFDTGNGIHRDETGEFR--GGWPHGSLGVQGSYSYTGDDGKQYTVNYTADKNGFH 140
:.:....|:|.::|.|||.|.||||.: .|...|||.||||.|::..|||:|.:::|||:.|:|
Fly 35 SENTGDKYSFAYETSNGISRTETGEVKPGAGEEDGSLSVQGSTSWSAPDGKKYEISFTADETGYH 99
Fly 141 140
Fly 100 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2EQ63 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1508073at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.920 |
|
Return to query results.
Submit another query.