DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and CG15515

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster


Alignment Length:113 Identity:36/113 - (31%)
Similarity:48/113 - (42%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AGHSFGGGSSYQRQQQPQIPIVRSDYNSDA--NGNYNFGFDTGNGIHRDETGEFRG-GWPHGSLG 113
            |.||..|...|      ..|.:.|:|.:.|  ...|.|..:..||..|:|.|.... |.|...|.
  Fly    17 AAHSSAGLLDY------VFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNPGTPDEQLV 75

  Fly   114 VQGSYSYTGDDGKQYTVN-YTADKNGFHA--EGAHLPVSPSVPAAPAG 158
            |.|.||...:.....||. |||||:|:.|  :..:..:||....:.||
  Fly    76 VMGMYSSYDEKTDTETVTMYTADKDGYKARYQIKNRKLSPGALKSAAG 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 21/55 (38%)
CG15515NP_001263088.1 Chitin_bind_4 46..102 CDD:278791 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.