DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and CG8927

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:130 Identity:25/130 - (19%)
Similarity:45/130 - (34%) Gaps:33/130 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 QRQQQPQIPIVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLG----VQGSYSYTGD 123
            ||::||....:|.....:.:|:..:|::..:|..::|.           :|    .:|:|.|...
  Fly   252 QRRRQPVSQTIRKWREENEDGSITWGYENDDGSFKEEL-----------IGTDCITKGTYGYVDP 305

  Fly   124 DGKQYTVNYTA---------------DKNGF---HAEGAHLPVSPSVPAAPAGRSSYGAGGSGYR 170
            ||.:...:|..               .:|||   ....|.||....:.....|:.........||
  Fly   306 DGNKREYHYETGIKCDPNNRNNEEELQENGFVNYEENRAVLPNGLEIDMTQLGKKKSKRPNGFYR 370

  Fly   171  170
              Fly   371  370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 11/72 (15%)
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791 11/70 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.