DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Edg78E

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:111 Identity:37/111 - (33%)
Similarity:53/111 - (47%) Gaps:20/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRSDYN--SDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYTAD 135
            :||..|  :||.|||.:.::|.|||...|.|        .:.|.:|:.:|...:|:..::.||||
  Fly    25 IRSFQNDATDAEGNYQYAYETSNGIQIQEAG--------NANGARGAVAYVSPEGEHISLTYTAD 81

  Fly   136 KNGFHAEGAHLPVSPSVPAAPAGRSSYGAGGSGYRGSASSHVPAAA 181
            :.|:|..|.|||..|.|||.......|          ..:|.||.|
  Fly    82 EEGYHPVGDHLPTPPPVPAYVLRALEY----------IRTHPPAPA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 15/53 (28%)
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439216
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.