DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:85 Identity:31/85 - (36%)
Similarity:42/85 - (49%) Gaps:9/85 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRSDYN--SDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYTAD 135
            :||..|  ...:|.||:.|:|.|||.:.|.|.       |.....||..|...:|:...:.||||
  Fly    32 IRSFVNELKQEDGIYNYQFETSNGIAQQEQGV-------GGYYASGSSQYYTPEGQLIQLTYTAD 89

  Fly   136 KNGFHAEGAHLPVSPSVPAA 155
            :|||..:|.|||....:|.|
  Fly    90 ENGFQPQGEHLPTPHPIPEA 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:459790 19/53 (36%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 19/53 (36%)

Return to query results.
Submit another query.