DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Cpr65Az

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:166 Identity:49/166 - (29%)
Similarity:74/166 - (44%) Gaps:39/166 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SQRYLPTPQASQLHYHGVSGQGQARPGAGHSFGGGSSYQRQQQPQIPIVRSDYNSDANGNYNFGF 89
            |..|||..          :|.|.:..|.|...|||.        .|||::.:...:.:|:|.:.:
  Fly    87 SNAYLPPG----------NGNGGSSGGGGAGGGGGE--------DIPIIKLESKVNTDGSYMYEY 133

  Fly    90 DTGNGIHRDETGEFRGGWPHGSLG--VQGSYSYTGDDGKQYTVNYTADKNGFHAEGAHLPVSPSV 152
            :|||||..:|.|..:.....|:..  .:||:|||..:|::.::.|.||:|||..:|.|||..|.:
  Fly   134 ETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDHLPTPPPI 198

  Fly   153 P--------AAPAGRSSYG-----------AGGSGY 169
            |        ...||...:|           .||.||
  Fly   199 PIEIQEALDKLAAGGGCHGCDDNETGGNDDGGGGGY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 19/55 (35%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.