DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Cpr49Af

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001286347.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:84 Identity:30/84 - (35%)
Similarity:45/84 - (53%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRSDYNSDANGNYNFGFDTGNGIHRDETGEFRG-GWPHGSLGVQGSYSYTGDDGKQYTVNYTADK 136
            :..:.|.:.||.|::.::..:|....:.|..:. ...|....|.|.||:..||||.|.|:||||:
  Fly    23 ISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTADE 87

  Fly   137 NGFHAEGAHLPVSPSVPAA 155
            ||:.|.|.|||..|..|.:
  Fly    88 NGYLAVGDHLPTPPPTPVS 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 19/54 (35%)
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.