DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Cpr47Eg

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster


Alignment Length:87 Identity:22/87 - (25%)
Similarity:43/87 - (49%) Gaps:9/87 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRG-GWPHGSLGVQGSYSYTGDDGKQYTVNYTAD 135
            ::|::...:.:| :.:..:..|.::..:.|:..| .|.     |:||.|:|..:....::.|.||
  Fly    22 VLRAEQQVNVDG-FAYAVELDNSVNVQQKGDLNGEEWV-----VKGSQSWTSPENVPVSIQYIAD 80

  Fly   136 KNGFHAEGAH--LPVSPSVPAA 155
            .||:....|:  ||..|.:|.|
  Fly    81 ANGYQVVSANPPLPTPPPIPEA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 13/54 (24%)
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.