powered by:
Protein Alignment Cpr11B and Cpr47Ed
DIOPT Version :9
Sequence 1: | NP_572807.1 |
Gene: | Cpr11B / 32203 |
FlyBaseID: | FBgn0030398 |
Length: | 197 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610658.1 |
Gene: | Cpr47Ed / 36192 |
FlyBaseID: | FBgn0033601 |
Length: | 127 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 40/72 - (55%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 IPIVRSDYNSDANGNYNFGFDTGNGIHRDETG--EFRGGWPHGSLGVQGSYSYTGDDGKQYTVNY 132
:||::|.....::|:|.|.|::.:|.:|:|.| ..........|.|.|.|.|..|.|::..|.|
Fly 28 VPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRY 92
Fly 133 TADKNGF 139
|||||||
Fly 93 TADKNGF 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.