DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:158 Identity:54/158 - (34%)
Similarity:76/158 - (48%) Gaps:40/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTVALVLFGFSSAILAGRLSQRYLPTPQASQLHYHGVSGQGQARPGAGHSFGGGSSYQRQQQPQI 70
            |.:||....|..|     ..||.||.|:                   |:||...:          
  Fly    11 LVLALCCLSFIQA-----QPQRGLPPPR-------------------GNSFDANA---------- 41

  Fly    71 PIVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLG---VQGSYSYTGDDGKQYTVNY 132
            .|::.:::.:.:|:|.:.::|.|||..||.|..:.  |...:.   :||||||||.||..||:.|
  Fly    42 VILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKN--PGSQIEAQVMQGSYSYTGPDGVVYTITY 104

  Fly   133 TADKNGFHAEGAHLPVSPSVPAAPA-GR 159
            .||:||:.|||||:|..|.|.||.| ||
  Fly   105 IADENGYRAEGAHIPTPPPVRAAAAPGR 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 25/56 (45%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 25/56 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439167
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.