DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Lcp1

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001260801.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster


Alignment Length:142 Identity:39/142 - (27%)
Similarity:57/142 - (40%) Gaps:32/142 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VSGQGQARPGAGHSFGGGSSYQRQQQPQIPIVRSDYNSDANGNYNFGFD----TGNGIHRDETGE 102
            |.|...|.|...||.|...........|...||:|           |||    |.|||.:..:|:
  Fly    10 VLGLAVANPPVPHSLGRSEDVHADVLSQSDDVRAD-----------GFDSSLHTSNGIEQAASGD 63

  Fly   103 FRGGWPHGSLGVQGSYSYTGDDGKQYTVNYTADKNGFHAEGAHLPVSPSVPAAPAGRSSYGAGGS 167
                 .||:  :.|::.:...:|:...|.|.|::||:...||.:|..|.:|.|.|...::     
  Fly    64 -----AHGN--IHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAW----- 116

  Fly   168 GYRGSASSHVPA 179
                 ..||.||
  Fly   117 -----LESHPPA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 16/57 (28%)
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.