DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Pcp

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:168 Identity:48/168 - (28%)
Similarity:68/168 - (40%) Gaps:38/168 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSSYQRQQQPQIPIVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLGVQGSYSYTGD 123
            ||||..........:::|...:.:|.|.:.::|.|||...:.|       .|.:.|||..|||..
  Fly    19 GSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEG-------LGGVAVQGGSSYTSP 76

  Fly   124 DGKQYTVNYTADKNGFHAEGAHLPVSPS--------VPAAPAGRSSY-----------GAGGSGY 169
            :|:..:|||.||:.|:|..|||:|..|.        :...|.....|           .|..:.|
  Fly    77 EGEVISVNYVADEFGYHPVGAHIPQVPDYILRSLEYIRTHPYQIKDYYTGELKTVEHDAAAFNVY 141

  Fly   170 RGSASSHV-----PAAAPATRYL--PP-----GYRQRR 195
            ..:...|.     |:..|.|.||  ||     ..||||
  Fly   142 TRNIQDHTIPQSRPSTTPKTIYLTHPPTTTSRPLRQRR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 19/53 (36%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439209
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.