DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11B and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:152 Identity:48/152 - (31%)
Similarity:71/152 - (46%) Gaps:28/152 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QARPGAGHSFGGGSSYQRQQQP--QIPIVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRG-GWP 108
            ||||..           |.|.|  .|||:|.:...:.:|:|.:.::|||||:.:|.|..:. |..
  Fly    17 QARPQV-----------RGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTD 70

  Fly   109 HGSLGVQGSYSYTGDDGKQYTVNYTADKNGFHAEGAHLPVSPSVPAAPAGRSSYGAGGSGYRGSA 173
            :.....|||:|||..:|....:.|.||:|||..:|.|||..|.:|.|..              .|
  Fly    71 NAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQ--------------KA 121

  Fly   174 SSHVPAAAPATRYLPPGYRQRR 195
            .:::..|.|..:..|.|:..||
  Fly   122 LAYLATAPPPPQEQPGGFNNRR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 20/54 (37%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450059
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.