DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mks1 and B9d1

DIOPT Version :9

Sequence 1:NP_572804.1 Gene:Mks1 / 32200 FlyBaseID:FBgn0030395 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster


Alignment Length:47 Identity:12/47 - (25%)
Similarity:20/47 - (42%) Gaps:12/47 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 RERCEGYAHYAIPL----TSALPTDSIRLQCIRP--------LGNWL 562
            ||...||||..:|:    ..|..|:.::...:.|        :.:||
  Fly   145 RETLLGYAHIHLPVFGSRRPADQTEQLQAPILMPKCPNMMADITSWL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mks1NP_572804.1 B9-C2 442..613 CDD:284557 12/47 (26%)
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.