powered by:
Protein Alignment Mks1 and B9d1
DIOPT Version :9
Sequence 1: | NP_572804.1 |
Gene: | Mks1 / 32200 |
FlyBaseID: | FBgn0030395 |
Length: | 699 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650470.1 |
Gene: | B9d1 / 41888 |
FlyBaseID: | FBgn0038342 |
Length: | 241 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 12/47 - (25%) |
Similarity: | 20/47 - (42%) |
Gaps: | 12/47 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 528 RERCEGYAHYAIPL----TSALPTDSIRLQCIRP--------LGNWL 562
||...||||..:|: ..|..|:.::...:.| :.:||
Fly 145 RETLLGYAHIHLPVFGSRRPADQTEQLQAPILMPKCPNMMADITSWL 191
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Mks1 | NP_572804.1 |
B9-C2 |
442..613 |
CDD:284557 |
12/47 (26%) |
B9d1 | NP_650470.1 |
B9-C2 |
61..226 |
CDD:284557 |
12/47 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45444220 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12968 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.