DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mks1 and B9d2

DIOPT Version :9

Sequence 1:NP_572804.1 Gene:Mks1 / 32200 FlyBaseID:FBgn0030395 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001188704.1 Gene:B9d2 / 10178891 FlyBaseID:FBgn0261683 Length:177 Species:Drosophila melanogaster


Alignment Length:159 Identity:29/159 - (18%)
Similarity:50/159 - (31%) Gaps:40/159 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 MKRVSLLLELQEGQNFENPNIHVRYYLKAPANTFYEGTPGVDTMQGATATCRNAGDWRSAH---L 494
            |..|.::.::.:..:|..|:::.::.|::                      .||  ||...   .
  Fly     1 MAEVHIIGQILKAVDFAEPHLYCKWSLQS----------------------GNA--WRLVQGEVQ 41

  Fly   495 GHCWQVTLLLEEQHHPADLLHLYFEVISIDSWQRERCE-------------GYAHYAIPLTSALP 546
            |.....:..|:.....|..|.::....|:..|.|...|             ||....:|.|....
  Fly    42 GQSHVASHRLQSSSDFAQPLDIHLSTASVQGWPRLLVEVYAVNVLQQSWPVGYGFVHVPSTPGTH 106

  Fly   547 TDSIRLQCIRPLGNWLDALNRYFIGGRQL 575
            ...|....:.|.|.|.....|:..||..|
  Fly   107 RLEIGTWKVAPNGLWQSLRERFGGGGAAL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mks1NP_572804.1 B9-C2 442..613 CDD:284557 27/150 (18%)
B9d2NP_001188704.1 B9-C2 4..165 CDD:399858 28/156 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.