DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr11A and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_572803.1 Gene:Cpr11A / 32198 FlyBaseID:FBgn0030394 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:133 Identity:29/133 - (21%)
Similarity:38/133 - (28%) Gaps:46/133 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSFLILLGFAALAAADVKHLT-------DRNLDLFKYNPSDIYTLPEDIDDDKPAVHFSGDVMK 58
            |.||..::.|..|....:.|.|       ||.: .::..|.|            |..|:|     
  Fly     1 MMSFGKIVVFLVLVLVQLIHCTRFTAPSLDRTI-YYRNTPPD------------PFGHYS----- 47

  Fly    59 AKTETLQNYNSGKKFKLELKTQNGIEVSSVGKLKDDKTFVVSGSYSFTGADGKRYKTRYTADEFG 123
                            .|.:|.|||.....|....     ..|...|...:|......|.||..|
  Fly    48 ----------------FEFQTTNGITTKGAGNENG-----AVGVVQFVSPEGIPVTFSYVADANG 91

  Fly   124 YHP 126
            |.|
  Fly    92 YQP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr11ANP_572803.1 Chitin_bind_4 73..124 CDD:459790 12/50 (24%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 13/71 (18%)

Return to query results.
Submit another query.