DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and AT5G59840

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_200792.1 Gene:AT5G59840 / 836105 AraportID:AT5G59840 Length:216 Species:Arabidopsis thaliana


Alignment Length:174 Identity:73/174 - (41%)
Similarity:105/174 - (60%) Gaps:12/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQT-VAYKTTTILLEGKRVKL 70
            |||||:|:||:|||.|||..:|....|         |:..||.|... :.:|..||.|:|||:||
plant    11 DYDYLIKLLLIGDSGVGKSCLLLRFSD---------GSFTTSFITTIGIDFKIRTIELDGKRIKL 66

  Fly    71 QLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNRLH 134
            |:|||:||.||.||..:|.|||.||:||||:|::.||:.|..|::.:::|| ..:.|:||||:..
plant    67 QIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKAD 131

  Fly   135 L-AFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELAR 177
            : ..||.|...:.:..|....:..||.|...|.|:.|.|..:|:
plant   132 MDESKRAVPKSKGQALADEYGIKFFETSAKTNLNVEEVFFSIAK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 73/174 (42%)
RAB 12..182 CDD:197555 68/169 (40%)
SOCS 192..234 CDD:295349
AT5G59840NP_200792.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 71/172 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.