DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and rasef

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_699335.4 Gene:rasef / 570731 ZFINID:ZDB-GENE-081105-157 Length:706 Species:Danio rerio


Alignment Length:176 Identity:61/176 - (34%)
Similarity:90/176 - (51%) Gaps:23/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKRVKLQLWDTSG 77
            :::|.||:.|||...|..|    .::.| .||  ||..| .|.::..|::::|....||||||:|
Zfish   509 RIVLAGDAAVGKSSFLLRL----CKNEF-KGN--TSATL-GVDFQMKTLVVDGVPTVLQLWDTAG 565

  Fly    78 QGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEV-DEHAPGIPKVLVGNRLHL------ 135
            |.||.:|.:||.|.|.|::|:||:|.:.||..:..|:..: |.....||.:||||:..|      
Zfish   566 QERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWVDIIEDVSQDDIPIMLVGNKTDLRKEALQ 630

  Fly   136 ----AFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELAR 177
                ........|.|.||::   :.| |.|.....||.|:...|||
Zfish   631 DGVTCIPTSYGEKLAMTYSA---LFC-ETSAKDGSNIIEAVLHLAR 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 61/176 (35%)
RAB 12..182 CDD:197555 61/176 (35%)
SOCS 192..234 CDD:295349
rasefXP_699335.4 EFh 9..69 CDD:238008
EF-hand_7 10..68 CDD:290234
DUF904 201..>253 CDD:283624
RAB 508..674 CDD:197555 61/176 (35%)
Rab 508..672 CDD:206640 59/174 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.