DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and rab44

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_689291.6 Gene:rab44 / 560799 ZFINID:ZDB-GENE-040724-117 Length:2402 Species:Danio rerio


Alignment Length:194 Identity:57/194 - (29%)
Similarity:89/194 - (45%) Gaps:16/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKT--TTILLEGKRVKLQLWDTS 76
            |::||:|.|||...:....    |..|      |.....|:...|  .|:.|..:.||||:|||:
Zfish  2220 VVMVGNSCVGKTSFIRRFH----EGQF------TEDYRSTIGVDTFVQTVELPDRTVKLQIWDTA 2274

  Fly    77 GQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNRLHLAFKRQ 140
            ||.||.:|.......|:|::|:|:||...||..|..|:.:..|.| ..:..:|:||: :.:..|:
Zfish  2275 GQERFHSITTQVFHKAEGLLLMYEITCSKSFISIRDWISQARERAQDDVVMMLLGNK-NDSVNRE 2338

  Fly   141 VAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNGM--EHIWRSNKVLSLQELCC 202
            |..::....|...|:...|.|.....|:.||...||.:.:.|...  ||.....:....:..||
Zfish  2339 VQIQEGADLAREYNIHFMECSAANGANVSESMRTLAELLVQRKRKREEHTTLRREPQQKKSGCC 2402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 57/194 (29%)
RAB 12..182 CDD:197555 52/170 (31%)
SOCS 192..234 CDD:295349 2/11 (18%)
rab44XP_689291.6 EIN3 <1419..>1534 CDD:296674
RAB 2218..2380 CDD:197555 52/170 (31%)
Rab 2218..2375 CDD:206640 51/165 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.