DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and rab12

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001018466.1 Gene:rab12 / 553657 ZFINID:ZDB-GENE-050522-555 Length:235 Species:Danio rerio


Alignment Length:214 Identity:82/214 - (38%)
Similarity:122/214 - (57%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKRVKLQLW 73
            ||.|:|:::|...|||    ::|.:..|:..||..  |.|.:  .|.:|..|:.|.||:::||:|
Zfish    33 DYKLQVIIIGSRGVGK----TSLMERFTDDTFCEA--CKSTV--GVDFKIKTVELRGKKIRLQIW 89

  Fly    74 DTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNRLHLAF 137
            ||:||.||.:|..:|.|||:||:||||||.:.:|:.:.:|:|.:|::| .....:||||:|....
Zfish    90 DTAGQERFNSITSAYYRGAKGIVLVYDITKQETFEDLPKWMKMIDKYASEDAELLLVGNKLDCES 154

  Fly   138 KRQVAAKQAETYASR-NNMSCFEISPLCNFNIRESFCE-----LARMALHRNGMEHIWRSNKVLS 196
            .|.::.:|||.:||| :.|...|.|...|||:.|.|.:     |::|.|.....|   .||.|||
Zfish   155 DRAISRQQAERFASRISGMRFCEASAKDNFNVDEIFLKLVDDILSKMPLEVPSKE---LSNSVLS 216

  Fly   197 LQ-------EL------CC 202
            ||       ||      ||
Zfish   217 LQPEPEIPPELPPPRMRCC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 82/214 (38%)
RAB 12..182 CDD:197555 68/176 (39%)
SOCS 192..234 CDD:295349 10/24 (42%)
rab12NP_001018466.1 Rab12 36..235 CDD:206699 78/209 (37%)
RAB 36..200 CDD:197555 66/171 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.