Sequence 1: | NP_727611.1 | Gene: | Rab40 / 32195 | FlyBaseID: | FBgn0030391 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018466.1 | Gene: | rab12 / 553657 | ZFINID: | ZDB-GENE-050522-555 | Length: | 235 | Species: | Danio rerio |
Alignment Length: | 214 | Identity: | 82/214 - (38%) |
---|---|---|---|
Similarity: | 122/214 - (57%) | Gaps: | 31/214 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 DYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKRVKLQLW 73
Fly 74 DTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNRLHLAF 137
Fly 138 KRQVAAKQAETYASR-NNMSCFEISPLCNFNIRESFCE-----LARMALHRNGMEHIWRSNKVLS 196
Fly 197 LQ-------EL------CC 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab40 | NP_727611.1 | P-loop_NTPase | 6..265 | CDD:304359 | 82/214 (38%) |
RAB | 12..182 | CDD:197555 | 68/176 (39%) | ||
SOCS | 192..234 | CDD:295349 | 10/24 (42%) | ||
rab12 | NP_001018466.1 | Rab12 | 36..235 | CDD:206699 | 78/209 (37%) |
RAB | 36..200 | CDD:197555 | 66/171 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |