DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and RAB8B

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_057614.1 Gene:RAB8B / 51762 HGNCID:30273 Length:207 Species:Homo sapiens


Alignment Length:177 Identity:75/177 - (42%)
Similarity:108/177 - (61%) Gaps:13/177 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCS--GNDCTSHILQTVAYKTTTILLEGK 66
            |.|.||||.|:||:|||.|||..:|....:.:..:.|.|  |.|          :|..||.|:||
Human     1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGID----------FKIRTIELDGK 55

  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVG 130
            ::|||:|||:||.||.||..:|.|||.||:|||||||:.|||.|..|::.::|||.. :.::::|
Human    56 KIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILG 120

  Fly   131 NRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELAR 177
            |:..:..||||:.::.|..|....:...|.|...:.|:.|:|..|||
Human   121 NKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLAR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 74/175 (42%)
RAB 12..182 CDD:197555 69/169 (41%)
SOCS 192..234 CDD:295349
RAB8BNP_057614.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 72/172 (42%)
Effector region. /evidence=ECO:0000250 37..45 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.