DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Rab44

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001351777.1 Gene:Rab44 / 442827 MGIID:3045302 Length:973 Species:Mus musculus


Alignment Length:177 Identity:60/177 - (33%)
Similarity:89/177 - (50%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGK 66
            |....|.|||..|:.:|||:|||...|..|.    ...|.:|...|    ..|.::...:|::.|
Mouse   776 GKPQADPDYLYHVVFLGDSNVGKTSFLHLLH----HDAFATGLTAT----VGVDFRVKNLLVDNK 832

  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEV-DEHAPGIPKVLVG 130
            ...||||||:||.|:.::.|...|.|:|::|:||:|::.||..:..||..: |....|:..||:|
Mouse   833 TFALQLWDTAGQERYHSLTRQLLRKAEGVVLMYDVTSQESFTHVRYWLDCLQDAGVEGVAMVLLG 897

  Fly   131 NRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELAR 177
            |::....:|||..:.....|....:|..|.|.....||.|....|||
Mouse   898 NKMDCEEERQVPTEAGRRLAQELGVSFGECSAALGHNILEPMMNLAR 944

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 59/173 (34%)
RAB 12..182 CDD:197555 55/167 (33%)
SOCS 192..234 CDD:295349
Rab44NP_001351777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
EF-hand_7 45..101 CDD:372618
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..140
SMC_prok_B <173..353 CDD:274008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..481
PHA03247 <425..783 CDD:223021 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 493..708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 724..779 1/2 (50%)
Rab 788..944 CDD:206640 53/163 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.