DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Rab7

DIOPT Version :10

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_524472.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster


Alignment Length:187 Identity:56/187 - (29%)
Similarity:95/187 - (50%) Gaps:37/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLKVLLVGDSDVGKHEIL--------SNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKR 67
            ||||:::|||.|||..::        ||....:..:.||                |..:::..:.
  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFC----------------TKEVVVNDRV 56

  Fly    68 VKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEV--------DEHAPGI 124
            |.:|:|||:||.||.::..::.|||...:||||:|...||..:|.|..|.        .:|   .
  Fly    57 VTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDH---F 118

  Fly   125 PKVLVGNRLHLAFKRQVAAKQAETYA-SRNNMSCFEISPLCNFNIRESFCELARMAL 180
            |.|::||::.|. .|||:.::|:.:. |:|::..:|.|.....|:..:|..:|:.||
  Fly   119 PFVVLGNKVDLD-NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNAL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop containing Nucleoside Triphosphate Hydrolases 6..265 CDD:476819 56/187 (30%)
SOCS 192..234 CDD:470605
Rab7NP_524472.1 Rab7 9..179 CDD:206655 55/186 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.