DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Rab23

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:178 Identity:56/178 - (31%)
Similarity:87/178 - (48%) Gaps:24/178 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTT--------TILL 63
            |.:..:||::||:..|||..::..         :|.|       :.|..||.|        .|.:
  Fly    33 DIELAIKVVIVGNGGVGKSSMIQR---------YCKG-------IFTKDYKKTIGVDFLERQIEI 81

  Fly    64 EGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPGIPKVL 128
            :|:.|::.||||:||..|..|.::|.||||..:||:..|::.|||.|..|.::|:.....||.|:
  Fly    82 DGEDVRIMLWDTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTVI 146

  Fly   129 VGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELA 176
            |.|::.|..:..|.|.:.||.|...|......|...:.|:...|..||
  Fly   147 VQNKIDLIEQAVVTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 56/178 (31%)
RAB 12..182 CDD:197555 55/173 (32%)
SOCS 192..234 CDD:295349
Rab23NP_649574.1 Ras 50..199 CDD:278499 49/161 (30%)
Rab23_like 50..197 CDD:133306 49/161 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.