DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and RabX5

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:245 Identity:62/245 - (25%)
Similarity:100/245 - (40%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVA--YKTTTILLEGKRVKLQLWDT 75
            ||:.|||..|||..|::.         ||. :...|:...|:.  ::.....:.|....|::|||
  Fly    66 KVIFVGDCSVGKTAIVNR---------FCY-DKFQSNYKATIGVDFELENFSILGHNYSLEMWDT 120

  Fly    76 SGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKE-VDEHAPGIPKV-LVGNRLHLAFK 138
            :||.||..|..:|.|.|..|::.||::.|.|.:...:||.. ::.:|...|.| |||.:..|..|
  Fly   121 AGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSK 185

  Fly   139 RQVAAKQ--AETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNGMEHIWRSNKVLSLQELC 201
            .:....:  |...|:......:.:|....|.:.|.|..:|.:|.....|:.| ||          
  Fly   186 EEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEI-RS---------- 239

  Fly   202 CRTIVRRTSVYAIDSLPLPPSVKSTLKSYALTTSQCFNSLTQSSKSKNRC 251
                        |.:.|...:.::::||........|.|.....||...|
  Fly   240 ------------IKNKPQEQATQASVKSQTFDLRNFFGSRLSQQKSGCTC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 62/245 (25%)
RAB 12..182 CDD:197555 49/174 (28%)
SOCS 192..234 CDD:295349 4/41 (10%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 49/173 (28%)
RAB 66..225 CDD:197555 47/168 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.