DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Cracr2a

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006506404.1 Gene:Cracr2a / 381812 MGIID:2685919 Length:751 Species:Mus musculus


Alignment Length:172 Identity:66/172 - (38%)
Similarity:93/172 - (54%) Gaps:11/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKRVKLQLW 73
            |.|.|::.||||.|||...|..|    .|:.|..|...|..|    .|:..|:.::..:|.||||
Mouse   563 DRLFKIVFVGDSAVGKTSFLRRL----CEARFSPGMAATVGI----DYRVKTVTVDNAQVALQLW 619

  Fly    74 DTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG--IPKVLVGNRLHLA 136
            ||:||.|:..|.:.:.|.|.|:.::||:|.|.||..|.:||..|:| |.|  ||.:|:||:|...
Mouse   620 DTAGQERYRCISQQFFRKADGVAVMYDLTAKQSFLSIRQWLSSVEE-AVGDRIPVLLLGNKLDNE 683

  Fly   137 FKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARM 178
            .:|:|.....|..|..||:..:|.|.....|.:||...|||:
Mouse   684 KEREVPRGLGEQLAKENNLIFYECSACSGHNAQESLLHLARL 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 66/172 (38%)
RAB 12..182 CDD:197555 64/169 (38%)
SOCS 192..234 CDD:295349
Cracr2aXP_006506404.1 PRK12309 <32..132 CDD:183426
Smc <142..>428 CDD:224117
Rab 566..724 CDD:206640 62/166 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.