DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and CG15399

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster


Alignment Length:189 Identity:39/189 - (20%)
Similarity:64/189 - (33%) Gaps:78/189 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LKVLLVGDSDVGK--------------------------------HE-----IL---------SN 30
            :::|::||..|||                                ||     ||         |:
  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76

  Fly    31 LEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKRVKLQLWDTSGQGRFCTIIR-SYSRGAQG 94
            .|| |...|:......|::||..|                :.:|.:...|.|...| |:.:...|
  Fly    77 SED-SENYPYMRSTPTTTNILYFV----------------EFYDLNSDWRMCRQQRESFYKNIDG 124

  Fly    95 IILVYDITNKWSFDGIDRW----LKEVDEHA----------PGIPKVLVGNRLHLAFKR 139
            |:|||::....|.|.:..|    |:::.:|.          ...|.::||..|....:|
  Fly   125 IVLVYNMLELSSQDSLHDWLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 39/189 (21%)
RAB 12..182 CDD:197555 39/189 (21%)
SOCS 192..234 CDD:295349
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 39/189 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.