DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Rab35

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster


Alignment Length:210 Identity:76/210 - (36%)
Similarity:115/210 - (54%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKRV 68
            |.:.:|:|.|:|::|||.|||..:|....|.:     .||:..|:   ..|.:|..|:.:||.||
  Fly     1 MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDT-----FSGSYITT---IGVDFKIRTVDIEGMRV 57

  Fly    69 KLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPGIPKVLVGNRL 133
            |||:|||:||.||.||..:|.||..|:|:|||:||..||..:.|||:|:..:...:.||||||:.
  Fly    58 KLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKN 122

  Fly   134 HLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMAL-HR-----NGME----HI 188
            ....::.|..:.|:.:|.:.::..||.|...|.|:...|..:.|..| |:     |..:    |:
  Fly   123 DDPDRKVVITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHL 187

  Fly   189 WRSNKVLSLQELCCR 203
             :.|...|....|||
  Fly   188 -KPNPKGSKGGKCCR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 75/208 (36%)
RAB 12..182 CDD:197555 65/170 (38%)
SOCS 192..234 CDD:295349 5/12 (42%)
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 73/206 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.