DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and RabX2

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster


Alignment Length:178 Identity:66/178 - (37%)
Similarity:94/178 - (52%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQT--VAYKTTTILLEGKRVKL 70
            :|||.|||::|||.|||..:|....|          :..|...|:|  :..|..::.|..:.:.|
  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSD----------DRFTEKYLRTMGIDVKARSVELVSRVMML 58

  Fly    71 QLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVGNRLH 134
            |:|||||..||.:::.|..|.|.||:||||||:..||..||.|:||:....|. :..:||||:..
  Fly    59 QVWDTSGDKRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSD 123

  Fly   135 LAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHR 182
            ....|||:.:|...||.|..:...|:|.....|:.:.|..||....||
  Fly   124 DPNHRQVSMEQGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 66/178 (37%)
RAB 12..182 CDD:197555 61/172 (35%)
SOCS 192..234 CDD:295349
RabX2NP_572627.1 RAB 8..171 CDD:197555 61/172 (35%)
Rab 8..165 CDD:206640 59/166 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.