Sequence 1: | NP_727611.1 | Gene: | Rab40 / 32195 | FlyBaseID: | FBgn0030391 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006256215.1 | Gene: | Rab44 / 309649 | RGDID: | 1560150 | Length: | 970 | Species: | Rattus norvegicus |
Alignment Length: | 213 | Identity: | 67/213 - (31%) |
---|---|---|---|
Similarity: | 98/213 - (46%) | Gaps: | 26/213 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGK 66
Fly 67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEV-DEHAPGIPKVLVG 130
Fly 131 NRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNGMEHIWRSNKVL 195
Fly 196 SLQEL----------CCR 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab40 | NP_727611.1 | P-loop_NTPase | 6..265 | CDD:304359 | 66/209 (32%) |
RAB | 12..182 | CDD:197555 | 56/170 (33%) | ||
SOCS | 192..234 | CDD:295349 | 6/22 (27%) | ||
Rab44 | XP_006256215.1 | RILP-like | <185..311 | CDD:304877 | |
RAB | 783..944 | CDD:197555 | 56/175 (32%) | ||
Rab | 785..941 | CDD:206640 | 54/163 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |