DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Rab44

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006256215.1 Gene:Rab44 / 309649 RGDID:1560150 Length:970 Species:Rattus norvegicus


Alignment Length:213 Identity:67/213 - (31%)
Similarity:98/213 - (46%) Gaps:26/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGK 66
            |....|.|||..|:.:|||:|||...|..|...|    |.:|...|    ..|.::...:|::.|
  Rat   773 GKPQADPDYLYHVIFLGDSNVGKTSFLHLLHHDS----FAAGLTAT----VGVDFRVKNLLVDNK 829

  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEV-DEHAPGIPKVLVG 130
            ...||||||:||.|:.::.|...|.|:|::|:||:|::.||..:..||..: |....|:..||:|
  Rat   830 TFALQLWDTAGQERYHSLTRQLLRKAEGVVLMYDVTSQESFTHVRYWLDCLQDAGVEGVAMVLLG 894

  Fly   131 NRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNGMEHIWRSNKVL 195
            |:.....:|||..:.....|....:|..|.|.....||.|....|||..       .:....:..
  Rat   895 NKTDCEEERQVPTEAGRRLAQELGISFGECSAALGHNILEPMMNLARSL-------KMQEDRQKA 952

  Fly   196 SLQEL----------CCR 203
            ||.|:          |||
  Rat   953 SLVEVTRQEPPKRAGCCR 970

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 66/209 (32%)
RAB 12..182 CDD:197555 56/170 (33%)
SOCS 192..234 CDD:295349 6/22 (27%)
Rab44XP_006256215.1 RILP-like <185..311 CDD:304877
RAB 783..944 CDD:197555 56/175 (32%)
Rab 785..941 CDD:206640 54/163 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.