DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and RAB40AL

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001027004.1 Gene:RAB40AL / 282808 HGNCID:25410 Length:278 Species:Homo sapiens


Alignment Length:284 Identity:161/284 - (56%)
Similarity:207/284 - (72%) Gaps:30/284 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGK 66
            |:..:.||:|||.|||||.||||.|||.:|:|.:.|||:       || |..:.||||||||:|:
Human     5 GSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGTAESPY-------SH-LGGIDYKTTTILLDGQ 61

  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPGIPKVLVGN 131
            ||||:|||||||||||||.|||||||||:||||||.|:|||:|:|||:|:::|||||:||:||||
Human    62 RVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVPKILVGN 126

  Fly   132 RLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNGMEHIWRSNKVLS 196
            ||||||||||..:||:.||.|..::.||:||||||||.|||.||||:.|.|:.:..:.|.:||||
Human   127 RLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRLNWLGRPSKVLS 191

  Fly   197 LQELCCRTIVRRTSVYAIDSLPLPPSVKSTLKSYALTTSQCFN---------SLTQSS--KSKNR 250
            ||:|||||||..|.|:.:|.||||.:::|.|||:::  ::..|         |||.||  |..:.
Human   192 LQDLCCRTIVSCTPVHLVDKLPLPIALRSHLKSFSM--AKGLNARMMRGLSYSLTTSSTHKRSSL 254

  Fly   251 CKT---------PTSSSRNSCAIA 265
            ||.         |.:.:||||.|:
Human   255 CKVKIVCPPQSPPKNCTRNSCKIS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 159/278 (57%)
RAB 12..182 CDD:197555 116/169 (69%)
SOCS 192..234 CDD:295349 24/41 (59%)
RAB40ALNP_001027004.1 P-loop_NTPase 9..278 CDD:328724 159/278 (57%)
SOCS_Rab40 187..228 CDD:239711 24/42 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2180
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 326 1.000 Inparanoid score I2481
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46774
OrthoDB 1 1.010 - - D1065856at2759
OrthoFinder 1 1.000 - - FOG0002583
OrthoInspector 1 1.000 - - otm42272
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1940
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.