DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Rab12

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_037149.1 Gene:Rab12 / 25530 RGDID:3527 Length:243 Species:Rattus norvegicus


Alignment Length:214 Identity:78/214 - (36%)
Similarity:120/214 - (56%) Gaps:29/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKRVKLQLW 73
            |:.|:|:::|...|||    ::|.:..|:..||..  |.|.:  .|.:|..|:.|.||:::||:|
  Rat    39 DFKLQVIIIGSRGVGK----TSLMERFTDDTFCEA--CKSTV--GVDFKIKTVELRGKKIRLQIW 95

  Fly    74 DTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNRLHLAF 137
            ||:||.||.:|..:|.|.|:|||||||||.|.:||.:.:|:|.:|::| .....:||||:|....
  Rat    96 DTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCET 160

  Fly   138 KRQVAAKQAETYASR-NNMSCFEISPLCNFNIRESFCELARMALHRNGMEHIWR---SNKVLSLQ 198
            .|:::.:|.|.:|.: ..|...|.|...|||:.|.|.:|....|.:..:: :.|   ||.:||||
  Rat   161 DREISRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLD-VLRSELSNSILSLQ 224

  Fly   199 -------EL--------CC 202
                   ||        ||
  Rat   225 PEPEIPPELPPPRPHVRCC 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 78/214 (36%)
RAB 12..182 CDD:197555 66/171 (39%)
SOCS 192..234 CDD:295349 9/26 (35%)
Rab12NP_037149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Rab12 42..243 CDD:206699 75/209 (36%)
Effector region. /evidence=ECO:0000250 70..78 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.