Sequence 1: | NP_727611.1 | Gene: | Rab40 / 32195 | FlyBaseID: | FBgn0030391 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037149.1 | Gene: | Rab12 / 25530 | RGDID: | 3527 | Length: | 243 | Species: | Rattus norvegicus |
Alignment Length: | 214 | Identity: | 78/214 - (36%) |
---|---|---|---|
Similarity: | 120/214 - (56%) | Gaps: | 29/214 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 DYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGKRVKLQLW 73
Fly 74 DTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNRLHLAF 137
Fly 138 KRQVAAKQAETYASR-NNMSCFEISPLCNFNIRESFCELARMALHRNGMEHIWR---SNKVLSLQ 198
Fly 199 -------EL--------CC 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab40 | NP_727611.1 | P-loop_NTPase | 6..265 | CDD:304359 | 78/214 (36%) |
RAB | 12..182 | CDD:197555 | 66/171 (39%) | ||
SOCS | 192..234 | CDD:295349 | 9/26 (35%) | ||
Rab12 | NP_037149.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..36 | ||
Rab12 | 42..243 | CDD:206699 | 75/209 (36%) | ||
Effector region. /evidence=ECO:0000250 | 70..78 | 3/9 (33%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |