DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and RAB40A

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_543155.2 Gene:RAB40A / 142684 HGNCID:18283 Length:277 Species:Homo sapiens


Alignment Length:283 Identity:162/283 - (57%)
Similarity:207/283 - (73%) Gaps:29/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILLEGK 66
            |:..:.||:|||.|||||.||||.|||.:|:|.:.|||:       || |..:.||||||||:|:
Human     5 GSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPY-------SH-LGGIDYKTTTILLDGQ 61

  Fly    67 RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPGIPKVLVGN 131
            ||||:|||||||||||||.|||||||||:||||||.|:|||:|:|||:|:::|||||:||:||||
Human    62 RVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVPKILVGN 126

  Fly   132 RLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNGMEHIWRSNKVLS 196
            ||||||||||..:||:.||.|..::.||:||||||||.|||.||||:.|.|:.|..:.|.:||||
Human   127 RLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRMNWLGRPSKVLS 191

  Fly   197 LQELCCRTIVRRTSVYAIDSLPLPPSVKSTLKSYALTTSQCFN---------SLTQSSKSKNR-C 251
            ||:|||||||..|.|:.:|.||||.:::|.|||:::  ::..|         |||.||..|:. |
Human   192 LQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSM--AKGLNARMMRGLSYSLTTSSTHKSSLC 254

  Fly   252 KT---------PTSSSRNSCAIA 265
            |.         |.:.:||||.|:
Human   255 KVEIVCPPQSPPKNCTRNSCKIS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 160/277 (58%)
RAB 12..182 CDD:197555 116/169 (69%)
SOCS 192..234 CDD:295349 24/41 (59%)
RAB40ANP_543155.2 P-loop_NTPase 9..277 CDD:328724 160/277 (58%)
SOCS_Rab40 187..228 CDD:239711 24/42 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2180
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 326 1.000 Inparanoid score I2481
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46774
OrthoDB 1 1.010 - - D1065856at2759
OrthoFinder 1 1.000 - - FOG0002583
OrthoInspector 1 1.000 - - otm42272
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1940
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.