DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and RAB10

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_057215.3 Gene:RAB10 / 10890 HGNCID:9759 Length:200 Species:Homo sapiens


Alignment Length:207 Identity:81/207 - (39%)
Similarity:113/207 - (54%) Gaps:20/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCS--GNDCTSHILQTVAYKTTTILLEGKRV 68
            |.||.|.|:||:|||.|||..:|....|.:..:.|.|  |.|          :|..|:.|:||::
Human     4 KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGID----------FKIKTVELQGKKI 58

  Fly    69 KLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNR 132
            |||:|||:||.||.||..||.|||.||:|||||||..||:.|.:||:.:|||| ..:.::|:||:
Human    59 KLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNK 123

  Fly   133 LHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNGMEH-------IWR 190
            ..:..||.|...:.|..|..:.:..||.|...|.||.::|..||...|.:..::.       |..
Human   124 CDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISS 188

  Fly   191 SNKVLSLQELCC 202
            ...|...:..||
Human   189 GGGVTGWKSKCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 81/207 (39%)
RAB 12..182 CDD:197555 73/172 (42%)
SOCS 192..234 CDD:295349 3/11 (27%)
RAB10NP_057215.3 Rab8_Rab10_Rab13_like 7..173 CDD:206659 75/175 (43%)
Effector region. /evidence=ECO:0000250 38..46 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.