Sequence 1: | NP_727611.1 | Gene: | Rab40 / 32195 | FlyBaseID: | FBgn0030391 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057215.3 | Gene: | RAB10 / 10890 | HGNCID: | 9759 | Length: | 200 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 81/207 - (39%) |
---|---|---|---|
Similarity: | 113/207 - (54%) | Gaps: | 20/207 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCS--GNDCTSHILQTVAYKTTTILLEGKRV 68
Fly 69 KLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNR 132
Fly 133 LHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNGMEH-------IWR 190
Fly 191 SNKVLSLQELCC 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab40 | NP_727611.1 | P-loop_NTPase | 6..265 | CDD:304359 | 81/207 (39%) |
RAB | 12..182 | CDD:197555 | 73/172 (42%) | ||
SOCS | 192..234 | CDD:295349 | 3/11 (27%) | ||
RAB10 | NP_057215.3 | Rab8_Rab10_Rab13_like | 7..173 | CDD:206659 | 75/175 (43%) |
Effector region. /evidence=ECO:0000250 | 38..46 | 4/17 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |