Sequence 1: | NP_727611.1 | Gene: | Rab40 / 32195 | FlyBaseID: | FBgn0030391 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598811.3 | Gene: | Rab15 / 104886 | MGIID: | 1916865 | Length: | 212 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 82/202 - (40%) |
---|---|---|---|
Similarity: | 119/202 - (58%) | Gaps: | 14/202 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQT-VAYKTTTILLEGKR 67
Fly 68 VKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAP-GIPKVLVGN 131
Fly 132 RLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMAL--HRNGMEHI-WRSNK 193
Fly 194 VLSLQEL 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab40 | NP_727611.1 | P-loop_NTPase | 6..265 | CDD:304359 | 81/200 (41%) |
RAB | 12..182 | CDD:197555 | 70/173 (40%) | ||
SOCS | 192..234 | CDD:295349 | 4/9 (44%) | ||
Rab15 | NP_598811.3 | Rab15 | 9..172 | CDD:206698 | 70/171 (41%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 192..212 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |