DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Rab28

DIOPT Version :9

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_081571.1 Gene:Rab28 / 100972 MGIID:1917285 Length:221 Species:Mus musculus


Alignment Length:233 Identity:67/233 - (28%)
Similarity:102/233 - (43%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTT--------TILLEG 65
            |..||::::||...||..:.:                |.:.......||.|        .|.|.|
Mouse    10 DRQLKIVVLGDGTSGKTSLAT----------------CFAQETFGKQYKQTIGLDFFLRRITLPG 58

  Fly    66 K-RVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRW---LKEVDEHAPGIPK 126
            . .|.||:||..||.....::..|..|||||:|||||||..||:.::.|   :|.|.|.:...|.
Mouse    59 NLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSEESETQPL 123

  Fly   127 V-LVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISP-------LCNFNIRESFCELARMALHRN 183
            | ||||::.|...|.|.|.:...:...|..|...:|.       ||   .::...|:..:.|::.
Mouse   124 VALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLC---FQKVAAEILGIKLNKA 185

  Fly   184 GMEHIWRSNKVLSL------QELCCRTI-VRRTSVYAI 214
            .:|   :|.:|:..      ||...||: ..|:|:.|:
Mouse   186 EIE---QSQRVVKADIVNYNQEPLSRTVNPPRSSMCAV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 67/233 (29%)
RAB 12..182 CDD:197555 56/189 (30%)
SOCS 192..234 CDD:295349 8/30 (27%)
Rab28NP_081571.1 Rab28 13..221 CDD:206694 66/230 (29%)
RAB 13..178 CDD:197555 55/183 (30%)
Effector region. /evidence=ECO:0000250 41..49 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.