DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15731 and Zmat1

DIOPT Version :9

Sequence 1:NP_572799.1 Gene:CG15731 / 32194 FlyBaseID:FBgn0030390 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_780655.2 Gene:Zmat1 / 215693 MGIID:2442284 Length:647 Species:Mus musculus


Alignment Length:100 Identity:18/100 - (18%)
Similarity:27/100 - (27%) Gaps:32/100 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 HGGHEEVKVVKVIHEEGGHSHDHGHSHGGFEEV--------KTIKVIHEDGGHAHGHGPAPIISN 291
            ||...||...||            :.|.|..:|        .....:|.....:....|:..:..
Mouse    72 HGEQSEVPGRKV------------NMHAGNSQVCSSGEVNRNNFTDLHNMSFDSLAAAPSHYVGK 124

  Fly   292 EYLPPSNEYL------------PPVSAPQPGYLPP 314
            .:.|..|:.|            |.:..|.....||
Mouse   125 SHSPTQNQSLEEHDQVSPSTCSPKMDEPNTTPAPP 159



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.