DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and DUN1

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_010182.1 Gene:DUN1 / 851457 SGDID:S000002259 Length:513 Species:Saccharomyces cerevisiae


Alignment Length:570 Identity:119/570 - (20%)
Similarity:215/570 - (37%) Gaps:144/570 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1346 ASMKKKLRKEKKKQKAKAAAAAEAKRFDPHKKIKIDTTNK----------CYVKEEAP------- 1393
            :|.|::.|  ..|..::...........|.|:.|::.||:          |.|....|       
Yeast    16 SSFKRQQR--SNKPSSEYTCLGHLVNLIPGKEQKVEITNRNVTTIGRSRSCDVILSEPDISTFHA 78

  Fly  1394 RYPLVATPRPLWKREKIVYSDENTDDESGSEEGSGGS--LDEDSDDESG-----GEECSSTSSSA 1451
            .:.|:......::|..|     |..|:|.:.....|:  :.:|...::|     |:.||.....|
Yeast    79 EFHLLQMDVDNFQRNLI-----NVIDKSRNGTFINGNRLVKKDYILKNGDRIVFGKSCSFLFKYA 138

  Fly  1452 SSEDLDAVAMVTKAGSSNATTVLDSSNSSGSNAGTLSVPSAGSGSGGGASTSSSPSIIRMSTCSN 1516
            ||...|.        .::...|...|.|..::......|...:.|...|:||::           
Yeast   139 SSSSTDI--------ENDDEKVSSESRSYKNDDEVFKKPQISATSSQNATTSAA----------- 184

  Fly  1517 DSGFEGGTAPSSPKKMLETSYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVL 1581
                                     .:|..: |.|.:..        |.:.....||.|.:..|.
Yeast   185 -------------------------IRKLNK-TRPVSFF--------DKYLLGKELGAGHYALVK 215

  Fly  1582 LAELRDTTYYYAIKCLKKDVVLEDDD--VDSTLIERKVLALGTKHPYLCHLFCTF-----QTESH 1639
            .|:.:.|....|:|.....   ::||  .:....|...:.:..:||.:.:|..:|     :::..
Yeast   216 EAKNKKTGQQVAVKIFHAQ---QNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQ 277

  Fly  1640 LFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLL------ 1698
            .:.|:|.::.|:|...|.......::.::....::::|||:||::.||:||:|.:|:||      
Yeast   278 KYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRE 342

  Fly  1699 -------------DYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWS 1750
                         :.:..|:|||||:.|....:..| ::.||||.|:|||::..:.|...||.||
Yeast   343 NPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFT-NTLCGTPSYVAPEVLTKKGYTSKVDLWS 406

  Fly  1751 FGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPA 1815
            .||:||..|.|..|||    |:|                 ....:.:.:|:..|     :.|||.
Yeast   407 AGVILYVCLCGFPPFS----DQL-----------------GPPSLKEQILQAKY-----AFYSPY 445

  Fly  1816 GDIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRL 1865
            .|..|......|...|:    :.|..:..:...|:..:|:.:..:..|.|
Yeast   446 WDKIDDSVLHLISNLLV----LNPDERYNIDEALNHPWFNDIQQQSSVSL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 72/283 (25%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 79/322 (25%)
DUN1NP_010182.1 FHA 36..136 CDD:238017 20/104 (19%)
STKc_CAMK 199..479 CDD:270687 76/313 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.