DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and WAG1

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_175774.1 Gene:WAG1 / 841807 AraportID:AT1G53700 Length:476 Species:Arabidopsis thaliana


Alignment Length:422 Identity:117/422 - (27%)
Similarity:188/422 - (44%) Gaps:70/422 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1472 TVLDSSNSSGSNAGTLSVPSAGSGSGGGASTSSSPSIIRMS-TCSNDSGFEGGTAPSSPKKMLET 1535
            |.||.|.:|.:...|.:            |:|:..|:.|.| |.|.:......|.||:......|
plant    10 TDLDLSFTSTATDRTFT------------SSSARSSLARSSLTLSFNDRLSTATTPSTTTSSAAT 62

  Fly  1536 SYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRD--TTYYYAIKCLK 1598
            :..:.::.........||.:.......:..|..:..||.|:.|:|.|..|||  ....:|:|.:.
plant    63 TLHHRRYDPHWTSIRAATTLSSDGRLHLRHFKLVRHLGTGNLGRVFLCHLRDCPNPTGFALKVID 127

  Fly  1599 KDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDL--MFHIQESGR 1661
            :| ||....:.....|.::|:| ..||:|..|:.......:...:::|...|||  :...|.:.|
plant   128 RD-VLTAKKISHVETEAEILSL-LDHPFLPTLYARIDASHYTCLLIDYCPNGDLHSLLRKQPNNR 190

  Fly  1662 FSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMC-------------- 1712
            ......||:.||::..|::||..||:|||||.:|:|:..:||:.::||.:|              
plant   191 LPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIMLSDFDLCFKADVVPTFRSRRF 255

  Fly  1713 ------------------------KLQIYLDKTAD-------SFCGTPDYMAPEIIKGEKYNQNV 1746
                                    :.:|..:..|:       |..||.:|:|||::.|..:...|
plant   256 RRTSSSPRKTRRGGGCFSTEVEYEREEIVAEFAAEPVTAFSKSCVGTHEYLAPELVAGNGHGSGV 320

  Fly  1747 DWWSFGVLLYEMLIGQSPFSGCDEDELFWSI-CNEIPWFPVYIS--AEATGILKGLLEKDYTKRI 1808
            |||:||:.|||||.|.:||.|..:::...:| .|:...|.:...  .||..:::.||.||..||:
plant   321 DWWAFGIFLYEMLYGTTPFKGGTKEQTLRNIVSNDDVAFTLEEEGMVEAKDLIEKLLVKDPRKRL 385

  Fly  1809 GSQYSPAGDIADHIFFRPIDWGLLEKRQIEPP 1840
            |.... |.||..|.||..|.|.|:  |..:||
plant   386 GCARG-AQDIKRHEFFEGIKWPLI--RNYKPP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 90/309 (29%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 97/323 (30%)
WAG1NP_175774.1 STKc_phototropin_like 91..416 CDD:270726 98/329 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.