DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and CPK33

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_001320603.1 Gene:CPK33 / 841492 AraportID:AT1G50700 Length:547 Species:Arabidopsis thaliana


Alignment Length:346 Identity:91/346 - (26%)
Similarity:156/346 - (45%) Gaps:46/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1510 RMSTCSNDSGFEGGTAPSSPKKMLETSYTYSQFQKSGRFTAPATVIPRFKNY-SVDDFHFLA-VL 1572
            |.||..:.|....||....|            ::...:.:..|.::.  |.| .|..|:.|: .|
plant    29 RRSTHQDPSKISTGTNQPPP------------WRNPAKHSGAAAILE--KPYEDVKLFYTLSKEL 79

  Fly  1573 GKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTE 1637
            |:|.||...|...:.|...:|.|.:.|..::...|.:....|.:::...:..|.:......::.|
plant    80 GRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKGDKEDMRREIQIMQHLSGQPNIVEFKGAYEDE 144

  Fly  1638 SHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLL---D 1699
            ..:..|||...||:|...|...|.:||..|.....:|::.:...|..|:::||||.:|.||   |
plant   145 KAVNLVMELCAGGELFDRILAKGHYSERAAASVCRQIVNVVNICHFMGVMHRDLKPENFLLSSKD 209

  Fly  1700 YEGHVRIADFGMCKLQIYLD--KTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQ 1762
            .:..::..|||   |.::::  :......|:..|:|||::| .:|.:.:|.||.|::||.:|.|.
plant   210 EKALIKATDFG---LSVFIEEGRVYKDIVGSAYYVAPEVLK-RRYGKEIDIWSAGIILYILLSGV 270

  Fly  1763 SPFSGCDEDELFWSIC-NEI-----PWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADH 1821
            .||....|..:|.:|. .||     ||  ..||..|..:::.:|.:|..:||.     |.::..|
plant   271 PPFWAETEKGIFDAILEGEIDFESQPW--PSISNSAKDLVRRMLTQDPKRRIS-----AAEVLKH 328

  Fly  1822 IFFR--------PIDWGLLEK 1834
            .:.|        |||..:|.:
plant   329 PWLREGGEASDKPIDSAVLSR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 75/269 (28%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 78/285 (27%)
CPK33NP_001320603.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.