DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and AT3G44610

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_190047.2 Gene:AT3G44610 / 823587 AraportID:AT3G44610 Length:451 Species:Arabidopsis thaliana


Alignment Length:513 Identity:131/513 - (25%)
Similarity:188/513 - (36%) Gaps:173/513 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1453 SEDLDAVAMVTKAGSSNATTVLDSSNSSGSNAGTLSVPSAGSGSGGGASTSSSPSIIRMSTCSND 1517
            ::||.:|:. |.||::...:....|.||.|.|.....|||    .|..|:|..|..:|.|     
plant     9 TDDLQSVSF-TSAGTTVNRSTSSGSRSSSSAAALTPAPSA----HGSFSSSKLPPSLRSS----- 63

  Fly  1518 SGFEGGTAPSSPKKMLETSYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLL 1582
                                                       .|:.|..|...||.|..|.|.|
plant    64 -------------------------------------------LSLSDLRFRLRLGSGDIGSVFL 85

  Fly  1583 AELRDTTY----------YYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTE 1637
            ||.:..|.          ..|.|.:.|..:...........||::|. ...||:|..|:....:.
plant    86 AEFKSLTAVTETTAVKLPLLAAKVMDKKELASRSKEGRAKTEREILE-SLDHPFLPTLYAAIDSP 149

  Fly  1638 SHLFFVMEYLNGGDLMFHI----QESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLL 1698
            ..|..:.|:..||||  |:    |...||.|...|||.:|:|..:::||..||:|||||.:|||:
plant   150 KWLCLLTEFCPGGDL--HVLRQKQTHKRFHESAVRFYVSEVIVAIEYLHMLGIVYRDLKPENVLV 212

  Fly  1699 DYEGHVRIADFGM---C-----KLQIYLD------------------------------------ 1719
            ..:||:.:.||.:   |     ..||.|:                                    
plant   213 RSDGHIMLTDFDLSLKCDESTSTPQIVLNRNNLPNGSSDQNENQGMDHRQTTSSSCMIPNCIVPA 277

  Fly  1720 ------------KTAD------------------SFCGTPDYMAPEIIKGEKYNQNVDWWSFGVL 1754
                        |..|                  ||.||.:|:||||:.||.:...||||:.|:.
plant   278 VSCFHPRIRRRKKKTDHRNNGPELVAEPVDVRSMSFVGTHEYLAPEIVSGEGHGSAVDWWTLGIF 342

  Fly  1755 LYEMLIGQSPFSGCDEDELFWSI---CNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAG 1816
            ::|:..|.:||.|.|.:....:|   ..|.|..|...|| |..::..||.||.::|:||... |.
plant   343 MFELFYGTTPFKGMDHELTLANIVARALEFPKEPTIPSA-AKDLISQLLAKDPSRRLGSSLG-AT 405

  Fly  1817 DIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILA 1874
            .:..|.||:.::|.||  ....|||.|                      .|..||:|:
plant   406 AVKRHPFFQGVNWALL--MCTRPPFLP----------------------PPFRKELLS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 96/348 (28%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 108/396 (27%)
AT3G44610NP_190047.2 PKc_like 71..424 CDD:304357 101/359 (28%)
S_TKc 75..413 CDD:214567 95/342 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.