DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and AGC1.5

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_187875.1 Gene:AGC1.5 / 820450 AraportID:AT3G12690 Length:577 Species:Arabidopsis thaliana


Alignment Length:471 Identity:131/471 - (27%)
Similarity:207/471 - (43%) Gaps:135/471 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1503 SSSPSIIRMSTCSNDSGFEGGT------APSS----PKKM--LETSYTYSQFQKSG--------- 1546
            ::|...::.:|.|:|    |.:      ||.:    |||:  |.||.|||...::.         
plant    72 TNSEGDLKHNTYSSD----GDSLAMRKNAPKNLHYDPKKIVPLTTSETYSPSARNHHHHRTKSPD 132

  Fly  1547 ---------------------------------RFTAPATVIPRFKNYSVDDFHFLAVLGKGSFG 1578
                                             |:.|..::..:.....:|:|..|..||.|..|
plant   133 KKRAPRHNGDYAYGDNLVGPSAQPFKPHTGGDVRWDAINSIASKGPQIGLDNFRLLKRLGYGDIG 197

  Fly  1579 KVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFV 1643
            .|.||:||.|...:|:|.:.|..:...:.:.....||::|:| ..||:|..|:..|:|:.....|
plant   198 SVYLADLRGTNAVFAMKVMDKASLASRNKLLRAQTEREILSL-LDHPFLPTLYSYFETDKFYCLV 261

  Fly  1644 MEYLNGGDL--MFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRI 1706
            ||:.:||:|  :...|.|.||:||.||||.:|::..|::||..|::|||||.:|:|:..|||:.:
plant   262 MEFCSGGNLHSLRQKQPSRRFTEEAARFYASEVLLALEYLHMLGVVYRDLKPENILVRDEGHIML 326

  Fly  1707 ADFGM---CKLQIYLDKTAD--------------------------------------------- 1723
            :||.:   |.....|.|::.                                             
plant   327 SDFDLSLRCTFNPTLVKSSSVCSGGGAILNEEFAVNGCMHPSAFLPRLLPSKKTRKAKSDSGLGG 391

  Fly  1724 ----------------SFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDE 1772
                            ||.||.:|:|||||:||.:...||||:||:.|||:|.|.:||.|.....
plant   392 LSMPELMAEPTDVRSMSFVGTHEYLAPEIIRGEGHGSAVDWWTFGIFLYELLHGTTPFKGQGNRA 456

  Fly  1773 LFWSICNEIPWFP--VYISAEATGILKGLLEKDYTKRIGSQYS-PAGDIADHIFFRPIDWGLLEK 1834
            ...::..:...||  .::|:.|..:::|||.||..:||.  |: .|.:|..|.||..::|.|:  
plant   457 TLHNVVGQPLKFPDTPHVSSAARDLIRGLLVKDPHRRIA--YTRGATEIKQHPFFEGVNWALV-- 517

  Fly  1835 RQIEPPFKPQVKHPLD 1850
            |...||..|.   |:|
plant   518 RSAAPPHIPD---PVD 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 102/326 (31%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 110/350 (31%)
AGC1.5NP_187875.1 STKc_phototropin_like 183..533 CDD:270726 113/356 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.