DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and SGK1

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_001137148.1 Gene:SGK1 / 6446 HGNCID:10810 Length:526 Species:Homo sapiens


Alignment Length:336 Identity:145/336 - (43%)
Similarity:203/336 - (60%) Gaps:17/336 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1565 DFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCH 1629
            |||||.|:|||||||||||..:....:||:|.|:|..:|:..:....:.||.||....|||:|..
Human   192 DFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVG 256

  Fly  1630 LFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLD 1694
            |..:|||...|:||::|:|||:|.:|:|....|.|.|||||.|||.|.|.:||...|:|||||.:
Human   257 LHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPE 321

  Fly  1695 NVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEML 1759
            |:|||.:||:.:.|||:||..|..:.|..:|||||:|:|||::..:.|::.||||..|.:|||||
Human   322 NILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEML 386

  Fly  1760 IGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFF 1824
            .|..||...:..|::.:|.|:.......|:..|..:|:|||:||.|||:|:: ....:|..|:||
Human   387 YGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAK-DDFMEIKSHVFF 450

  Fly  1825 RPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMDQ----------- 1878
            ..|:|..|..::|.|||.|.|..|.|.::||..||.|     |:...|..|.|.           
Human   451 SLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEE-----PVPNSIGKSPDSVLVTASVKEAA 510

  Fly  1879 KQFHGFTYTNP 1889
            :.|.||:|..|
Human   511 EAFLGFSYAPP 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 117/257 (46%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 139/329 (42%)
SGK1NP_001137148.1 S_TKc 193..450 CDD:214567 117/257 (46%)
STKc_SGK 197..519 CDD:270727 138/327 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.