DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and sgk1

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_012818527.1 Gene:sgk1 / 594981 XenbaseID:XB-GENE-1003518 Length:434 Species:Xenopus tropicalis


Alignment Length:380 Identity:151/380 - (39%)
Similarity:215/380 - (56%) Gaps:35/380 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1521 EGGTAPSSPKKMLETSYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAEL 1585
            |..:.|.||.:.:....:.:...|.                  .||.||.::|||||||||||..
 Frog    74 ENSSPPPSPSQQINLGPSSNPHAKP------------------SDFQFLKIIGKGSFGKVLLARH 120

  Fly  1586 RDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGG 1650
            .....:||:|.|:|..:|:..:....:.||.||....|||:|..|..:|||.|.|:|:::|:|||
 Frog   121 NADEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTTSRLYFILDYINGG 185

  Fly  1651 DLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQ 1715
            :|.:|:|....|.|.|||||.|||.|.|.:||...|:|||||.:|:|||.:||:.:.|||:||..
 Frog   186 ELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDFGLCKEN 250

  Fly  1716 IYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNE 1780
            |..:.|..:|||||:|:|||::..:.|::.||||..|.:|||||.|..||...:..|::.:|.|:
 Frog   251 IEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNK 315

  Fly  1781 IPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPIDWGLLEKRQIEPPFKPQV 1845
            .......|:..|..:|:|||:||.|||||:: :...:|.:|:||.||:|..|..::|.|||.|.|
 Frog   316 PLQLKPNITNSARNLLEGLLQKDRTKRIGAK-NDFMEIKNHMFFSPINWDDLINKKITPPFNPNV 379

  Fly  1846 KHPLDTQYFDRVFTRERVRLTPIDKEILASMDQ-----------KQFHGFTYTNP 1889
            ..|.|.|:||..||.|     |:...|..|.|.           :.|.||:|..|
 Frog   380 SGPSDLQHFDPEFTEE-----PVPNSIGQSPDSILITASIKEAAEAFMGFSYAPP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 116/257 (45%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 141/329 (43%)
sgk1XP_012818527.1 STKc_SGK1 93..431 CDD:270753 147/361 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.