DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and PRKCH

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_006246.2 Gene:PRKCH / 5583 HGNCID:9403 Length:683 Species:Homo sapiens


Alignment Length:417 Identity:199/417 - (47%)
Similarity:262/417 - (62%) Gaps:37/417 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1481 GSNAGTLSVPSAGSGSGGGASTSSSPSIIRMSTC---SNDSGFEG-GTAPSSPKKMLETSYTYSQ 1541
            |.||..|:...||.|...| :.|.:..::..||.   ..:|..|| |...:|..::         
Human   296 GVNAVELAKTLAGMGLQPG-NISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRL--------- 350

  Fly  1542 FQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDD 1606
                                .:|:|.|:.||||||||||:||.:::|...||:|.|||||:|:||
Human   351 --------------------GIDNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDD 395

  Fly  1607 DVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYG 1671
            ||:.|:.|:::|:|...||:|..|||.|||...||||||::||||||||||:|.||.|.|||||.
Human   396 DVECTMTEKRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYA 460

  Fly  1672 AEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEI 1736
            |||||.|.|||.||||||||||||||||:|||.::|||||||..|....|..:|||||||:||||
Human   461 AEIISALMFLHDKGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEI 525

  Fly  1737 IKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLE 1801
            ::...|...||||:.||||||||.|.:||...:||:||.:|.|:...:|.::..:||||||..:.
Human   526 LQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMT 590

  Fly  1802 KDYTKRIGSQYSPAGD--IADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVR 1864
            |:.|.|:|| .:..|:  |..|.||:.|||..|..|||||||:|::|...|...||..|.:|...
Human   591 KNPTMRLGS-LTQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPV 654

  Fly  1865 LTPIDKEILASMDQKQFHGFTYTNPHI 1891
            |||||:..|..::|.:|..|:|.:|.:
Human   655 LTPIDEGHLPMINQDEFRNFSYVSPEL 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 151/259 (58%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 179/320 (56%)
PRKCHNP_006246.2 C2_PKC_epsilon 8..140 CDD:175981
C1_1 172..225 CDD:278556
C1_1 246..298 CDD:278556 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..342 5/21 (24%)
S_TKc 355..614 CDD:214567 151/259 (58%)
STKc_nPKC_eta 359..681 CDD:270742 180/322 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D222529at2759
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 1 1.000 - - X125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.