DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and PRKCG

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_001303258.1 Gene:PRKCG / 5582 HGNCID:9402 Length:710 Species:Homo sapiens


Alignment Length:541 Identity:230/541 - (42%)
Similarity:290/541 - (53%) Gaps:79/541 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1373 DPHKKIKI--DTTNKCYVKEEAPRYPLVATPRPLWKREKIVYSDENTDDESGSEEGSGGSLDEDS 1435
            ||:.|:|:  |..|....|....:    ||..|:| .|..|::.:..|.|...      |::...
Human   193 DPYVKLKLIPDPRNLTKQKTRTVK----ATLNPVW-NETFVFNLKPGDVERRL------SVEVWD 246

  Fly  1436 DDESGGEECSSTSSSASSEDLDAVA------MVTKAGSSNATTVLDSSNSS------GSNAGTLS 1488
            .|.:...:.....|...||.|.|..      :..:.|......|.|:.|.|      ..|.....
Human   247 WDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLEL 311

  Fly  1489 VPSAGSGSGGGASTSSSPSIIRMSTCSNDSGFEGGTAPSSPKKMLETSYTYSQFQKS-GRFTAPA 1552
            ......|.......|.|||                  |:.||:..        |..| ||.    
Human   312 YERVRMGPSSSPIPSPSPS------------------PTDPKRCF--------FGASPGRL---- 346

  Fly  1553 TVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKV 1617
                     .:.||.||.||||||||||:|||.|.:...||||.|||||:::|||||.||:|::|
Human   347 ---------HISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRV 402

  Fly  1618 LALGTKHP-----YLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISG 1677
            ||||.:.|     :|..|..||||...|:|||||:.|||||:|||:.|:|.|..|.||.|||..|
Human   403 LALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIG 467

  Fly  1678 LKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKY 1742
            |.|||.:||||||||||||:||.|||::|.||||||..::...|..:|||||||:|||||..:.|
Human   468 LFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPY 532

  Fly  1743 NQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKR 1807
            .::||||||||||||||.||.||.|.||:|||.:|..:...:|..:|.||..|.||.|.|...||
Human   533 GKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKR 597

  Fly  1808 IGSQYSPAGD--IADHIFFRPIDWGLLEKRQIEPPFKPQVKHPL--DTQYFDRVFTRERVRLTPI 1868
            :||  .|.|:  |..|.|||.|||..||:.:|.|||:|:   |.  ..:.||:.|||....|||.
Human   598 LGS--GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPR---PCGRSGENFDKFFTRAAPALTPP 657

  Fly  1869 DKEILASMDQKQFHGFTYTNP 1889
            |:.:|||:||..|.||||.||
Human   658 DRLVLASIDQADFQGFTYVNP 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 154/264 (58%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 184/327 (56%)
PRKCGNP_001303258.1 C1_1 36..88 CDD:278556
C1_1 101..153 CDD:278556
C2_PKC_alpha_gamma 158..289 CDD:175992 23/106 (22%)
S_TKc 351..614 CDD:214567 154/264 (58%)
STKc_cPKC 354..677 CDD:270739 185/327 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143719at33208
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.